PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00273g00087.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 191aa    MW: 21617.3 Da    PI: 10.3843
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00273g00087.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.97.6e-1687132148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
           Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                               rg++++eE++l+++++  lG++ W+++a+ ++ gRt++++k+ w+++l
  Peaxi162Scf00273g00087.1  87 RGPFSEEEEKLIIQLHGILGNR-WAAVASQLP-GRTDNEIKNLWNTHL 132
                               89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-96994IPR009057Homeodomain-like
SuperFamilySSF466891.0E-2070139IPR009057Homeodomain-like
PROSITE profilePS5129424.93382136IPR017930Myb domain
SMARTSM007179.9E-1586134IPR001005SANT/Myb domain
PfamPF002494.4E-1587132IPR001005SANT/Myb domain
CDDcd001673.95E-1189132No hitNo description
Gene3DG3DSA:1.10.10.606.8E-2295133IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
FKFHPKDPKK ANVIVCALGN ICRHWQSLLL VSLLLLLAIE LCTLSVSLAF LDAVSTLKGP  60
EERNILLQCG KSCCLRWTNY LRPDIKRGPF SEEEEKLIIQ LHGILGNRWA AVASQLPGRT  120
DNEIKNLWNT HLKKRLFSMG IDPHTHEPSS VPSGLVRRPP TSSSTRHMAQ WGSARLQAEA  180
RLKIHIFRFP L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-207013642108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016458219.13e-67PREDICTED: transcription factor MYB122-like
RefseqXP_009629649.13e-67PREDICTED: transcription factor MYB28-like
SwissprotQ50EX62e-40ODO1_PETHY; Protein ODORANT1
TrEMBLA0A0V0HZZ06e-66A0A0V0HZZ0_SOLCH; Uncharacterized protein
STRINGPGSC0003DMT4000557633e-65(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.12e-63myb domain protein 17